中国P站

ISSN: 2155-952X
Journal of Biotechnology & Biomaterials
Make the best use of Scientific Research and information from our 700+ peer reviewed, Open Access Journals that operates with the help of 50,000+ Editorial Board Members and esteemed reviewers and 1000+ Scientific associations in Medical, Clinical, Pharmaceutical, Engineering, Technology and Management Fields.
Meet Inspiring Speakers and Experts at our 3000+ Global Events with over 600+ Conferences, 1200+ Symposiums and 1200+ Workshops on Medical, Pharma, Engineering, Science, Technology and Business

Quantitative Immunoproteomics Approach for the Development of MHC Class I Associated Peptide Antigens of Alpha-Cobra Toxin from Naja kaouthia

Sherkhane AS, Changbhale SS and Gomase VS*

The Global Open University, Nagaland, India

Corresponding Author:
Virendra S Gomase
The Global Open University
Nagaland, India
E-mail: gomase.viren@gmail.com

Received date: October 30, 2014; Accepted date: November 25, 2014; Published date: December 03, 2014

Citation: Sherkhane AS, Changbhale SS, Gomase VS (2014) Quantitative Immunoproteomics Approach for the Development of MHC Class I Associated Peptide Antigens of Alpha-Cobra Toxin from Naja kaouthia. J Biotechnol Biomater 4:169. doi:10.4172/2155-952X.1000169

Copyright: © 2014 Sherkhane AS, et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.

Visit for more related articles at Journal of Biotechnology & Biomaterials

Abstract

Alpha-Cobratoxin from N. kaouthia binds to acetylcholine receptors which are located in neuromuscular junctions, once activated; they cause contract muscles and block their actions thereby bringing on muscle paralysis. Peptide fragments of Alpha-Cobratoxin from N. kaouthia having 71 amino acids, which shows 63 nonamers and are used synthetic peptide vaccine design and to increase the understanding of roles of the immune system against snake bite. For the immune responses against a protein antigen, it is clear that the whole protein is not necessary for raising the immune response, but small segments (15-PNGHVCYTKT-24, 26-CDAFCSIRG-34 and 36-RVDLGCAATCPTVKTGVDIQCCSTD-60) of Alpha-Cobratoxin protein from N. kaouthia called the antigenic determinants or the epitopes are sufficient for eliciting the desired immune response. The identification of specific peptides that binds to MHC class I molecules is important to recognize T-cell epitopes. In this research work, we predict antigenicity, Solvent accessibility to identify the membrane-spanning regions (hydrophobic) or regions that are likely exposed on the surface of proteins (hydrophilic domains) which are potentially antigenic that are used to design synthetic peptide vaccine.

Keywords

Alpha-cobratoxin; N. kaouthia; Antigenic peptides; MHC-binders; TapPred; PSSM

Introduction

The N. kaouthia is also called monocled cobra, is widespread across central and southern Asia regions [1]. It can adapt habitats from natural to anthropogenically impacted environments and are most active at dusk. Alpha-Cobratoxin from N. kaouthia venoms are postsynaptic neurotoxins, that have high affinity to muscular, Torpedo and neuronal alpha-7 nicotinic acetylcholine receptors which block the nerve transmission by binding specifically to the nicotinic acetylcholine receptor, leading paralysis and even death occurred due to respiratory failure [2-4]. Alpha-Cobratoxin N. kaouthia antigenic peptides are most suitable for vaccine development because an ample immune response can be generated even with single epitope. Major histocompatibility complex (MHC) molecules are cell surface proteins that binds to the peptides of antigenic proteins, present them at the cell surface and are recognized by T-cells [5,6]. T cell recognition is a fundamental mechanism by which the host identifies and responds to foreign antigens [7,8]. The MHC molecule is extremely polymorphic [9]. MHC class I molecules are expressed on most nucleated cells, generally present peptides from intracellular proteins that are targeted by proteasome, cleaved them into short peptides of 8-11 amino acids in length. These peptides are bound by the transmembrane peptide transporter (TAP) and translocate them from cytoplasm to endoplasmic reticulum, where they are bound by MHC molecule to elicit an immune response via T-cell. T cells also recognize selfpeptides but are eliminated during the thymic selection; therefore, the primary targets of T cell to recognize [10] foreign peptides and kill host target cells. The second and the C-terminal position of the peptide are the most important for binding [11,12] and the amino acids at each position contribute a certain binding energy [13]. Therefore, the identification of MHC-binding peptides and T-cell epitopes and study of antigenic properties helps to improve our understanding of specificity of immune responses are important for the development of new vaccines. However, this theme is implemented in designing synthetic peptide vaccines.

Materials and Methods

Antigenic epitopes of Alpha-Cobratoxin from N. kaouthia are determined by using the Hopp and Woods, Welling, Parker, Bepipred, Kolaskar and Tongaonkar antigenicity methods to predicts those segments which are likely to be antigenic by eliciting an immune response. [16-20]. The MHC peptide binding of antigen protein is predicted by using neural networks trained on C terminals of known epitopes. Rankpep predicts peptide binders to MHC-I ligands whose C-terminal end is likely to be the result of proteosomal cleavage using Position Specific Scoring Matrices (PSSMs) [21-28]. We predict cascade SVM based several TAP binders which was based on the sequence and the features of amino acids [29]. We also predict solvent accessible regions of proteins having highest probability that a given protein region lies on the surface of a protein Surface Accessibility, backbone or chain flexibility by Emani et al. [30] and Karplus and Schulz to identify active site of functionally important residues in membrane proteins. [31]. By using different scale we predict the hydrophobic and hydrophilic characteristics of amino acids that are rich in charged and polar residues i.e. Sweet et al., Kyte and Doolittle, Abraham and Leo, Bull and Breese, Miyazawa et al., Roseman, Wolfenden et al., Wilson et al., Cowan, Chothia [32-41].

Results and Interpretation

A antigenic sequence of Alpha-Cobratoxin from N. kaouthia is 71 residues long as- >gi| 128930|sp|P01391.1| NXL1_KAIRCFITP DITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP

Prediction of antigenic peptides

Antigenicity is predicted by identifying antigenic determinants by finding the area of greatest local hydrophilicity. The Hopp-Woods scale Hydrophilicity Prediction Result Data found high in position 9-11, 13- 15, 33-37 (1.243) in a protein, assuming that the antigenic determinants would be exposed on the surface of the protein and thus would be located in hydrophilic regions (Figures 1 and 2). Welling antigenicity plot gives value as the log of the quotient between percentage in a sample of known antigenic regions and percentage in average proteins and Prediction Result Data found high in position 20-21 (0.440), 36-38 (Figure 3). We also study Hydrophobicity plot of HPLC/Parker Hydrophilicity Prediction Result Data found 7-PDITSKD-13 (4.500), 8-DITSKDC-14 (4.400), 10-TSKDCPN-16 (5.414), 11-SKDCPNG-17 (5.486), 55-QCCSTDN- 61(5.357),57-CSTDNCN-63(5.500),58-STDNCNP-64(5.600) (maximum) (Figure 4), BepiPred predicts the location of linear B-cell epitopes Result found that 9-ITSKDCPNG-17,45-CPTVKT-50, (Figure 5) (Table 3), Kolaskar and Tongaonkara semi-empirical method used for prediction of antigenic determinants on protein antigens. Predicted peptides result found i.e. 15-PNGHVCYTKT-24, 26-CDAFCSIRG-34, 36-RVDLGCAATCPTVKTGVDIQCCSTD-60, (Figure 6) (Table 4). The maximal hydrophilicity region is assumed to be an antigenic site, having hydrophobic characteristics, because terminal regions of antigen protein are solvent accessible and unstructured; antibodies against those regions are also likely to recognize the native protein.

biotechnology-biomaterials-Alpha-Cobratoxin

Figure 1: Biological assembly image for Alpha-Cobratoxin protein. X-ray structure (4AEA) of Alpha-Cobratoxin from N. kaouthia showing the location of disulfides and possible mode of binding to nicotinic acetylcholine receptors.

biotechnology-biomaterials-Hopp-Woods

Figure 2: Hydrophobicity plot of Hopp and Woods (1981) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Welling

Figure 3: Hydrophobicity plot of Welling et al. (1985) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-HPLC-Parker

Figure 4: Hydrophobicity plot of HPLC / Parker et al. (1986) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Bepipred-Linear

Figure 5: Bepipred Linear Epitope Prediction plot showing antibody recognized B-cell epitopes of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Kolaskar-Tongaonkar

Figure 6: Kolaskar and Tongaonkar antigenicity plot for the Alpha-Cobratoxin from N. kaouthia.

Solvent accessible regions

We also predict solvent accessible regions in proteins to identify antigenic activity, surface region of peptides. Emani et al., (Figure 7) predicts the highest probability i.e. found 7-PDITSK-12 (2.082), 8-DITSKD-13 (2.248), 31-SIRGKR-36 (2.121), 33-RGKRVD-38 (2.798), 63-NPFPTR-68 (2.798), 64-PFPTRK-69 (3.480), 65-FPTRKR-70 (4.408), 66-PTRKRP-71 (7.872) (maximum), that a given protein region lies on the surface of a protein and are used to identify antigenic determinants on the surface of proteins. Karplus and Schulz (Figure 8) method used for the Selection of Peptide Antigens. High score is found in residue i.e. 6-TPDITSK-12 (1.064), 7-PDITSKD-13 (1.077), 8-DITSKDC-14 (1.084) (maximum), 9-ITSKDCP-15 (1.078), 10-TSKDCPN-16 (1.074), 11-SKDCPNG-17 (1.062). Karplus and Schulz Predict backbone or chain flexibility on the basis of the known temperature B factors of the a-carbons. The hydrophobicity and hydrophilic characteristics of amino acids is determined by using different scales that are rich in charged and polar residues i.e. Sweet et al. hydrophobicity prediction Result Data found high in position 4 (0.461), 6-7, 21-23, Kyteand Doolittle result high in position 4,6-7, 29- 31, 40-44 (1.614), Abraham and Leo result data shows high in position 6-7 (1.230), 27-29, 40-42, Bull and Breese result high in position 13-16, 43-44, 58-61 (0.557),Guy result high in position 9-10, 13-15, 33-37, 66-68 (0.661), Miyazawa result high in position 4-7 (6.737), 27-31, 41- 42, 54-57, Roseman result high in position 6-7 (0.334), 17-18,42-45, Wolfenden result high in position 42 (0.170), Wilson et al. 4-6, 17-19, 22-23, 26-32 (3.671), 39-40, 54-55, Cowan 4-7 (0.899), 27-29, 40-42, Chothia4-8, 27-32 (0.407), 39-45, 53-57, (Figures 9-19).

biotechnology-biomaterials-Alpha-Cobratoxin

Figure 7: Emini Surface Accessibility Prediction plot of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Schulz-Flexibility

Figure 8: Karplus and Schulz Flexibility Prediction of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Hydrophobicity-plot

Figure 9: Hydrophobicity plot of Sweet et al. (1983) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Kyte-Doolittle

Figure 10: Kyte and Doolittle hydrophobicity plot of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Leo-hydrophobicity

Figure 11: Abraham & Leo hydrophobicity plot of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Bull-Breese

Figure 12: Bull & Breese use surface tension to measure hydrophobicity of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Miyazawa

Figure 13: Hydrophobicity plot of Miyazawa et al. (1985) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-N-kaouthia

Figure 14: Hydrophobicity plot of Guy (1988) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Wolfenden

Figure 15: Hydrophobicity plot of Wolfenden et al.(1981) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-RosemanM

Figure 16: Hydrophobicity plot of RosemanM.A.. (1988) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-HPLC-plot-Wilson

Figure 17: Hydrophobicity/HPLC plot of Wilson & al (1981) of Alpha-Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Cowan

Figure 18: Hydrophobicity/HPLC pH 3.4/ plot of Cowan (1990) of Alpha- Cobratoxin from N. kaouthia.

biotechnology-biomaterials-Chothia

Figure 19: Hydrophobicity plot of Chothia (1976) of Alpha-Cobratoxin from N. kaouthia.

Prediction of MHC binding peptide

We predict the peptide binders of Alpha-Cobratoxin from N. kaouthia to MHC-I molecules to a number of different alleles using Position Specific Scoring Matrix. Alpha-Cobratoxin from N. kaouthia sequence is 71 residues long, having 63 nonamers. MHC molecules are cell surface proteins, which actively participate in host immune reactions and involvement of MHC-I in response to almost all antigens. We have predicted MHC-I peptide binders of Alpha-Cobratoxin from N. kaouthia was tested with on a set of 4 different alleles i.e. H2-Db (mouse) 8mer, H2-Db (mouse) 9mer, H2-Db (mouse) 10mer, H2-Db (mouse) 11mer (Tables 1a-1d). Here RANKPEP report PSSM-specific binding threshold and is obtained by scoring all the antigenic peptide sequences included in the alignment from which a profile is derived, and is defined as the score value that includes 85% of the peptides within the set. Peptides whose score is above the binding threshold will highlighted in (Tables 1a-1d) and peptides produced by the cleavage prediction model are highlighted in (Table 2). We also use a cascade SVM based TAPP red method which found 25 High affinity TAP Transporter peptide regions which represents predicted TAP binders residues which occur at N and C termini from Alpha-Cobratoxin from N. kaouthia.

MHC-I Allele POS N SEQUENCE C MW (Da) SCORE % OPT.
8mer_H2_Db 41 DLG CAATCPTV KTG 746.89 21.518 40.99 %
8mer_H2_Db 61 STD NCNPFPTR KRP 930.05 10.742 20.46 %
8mer_H2_Db 58 QCC STDNCNPF PTR 878.91 3.74 7.12 %
8mer_H2_Db 2 I RCFITPDI TSK 946.14 0.021 0.04 %
8mer_H2_Db 14 SKD CPNGHVCY TKT 874.0 -0.041 -0.08 %
8mer_H2_Db 23 CYT KTWCDAFC SIR 932.11 -0.625 -1.19 %
8mer_H2_Db 18 PNG HVCYTKTW CDA 996.17 -4.872 -9.28 %
8mer_H2_Db 12 ITS KDCPNGHV CYT 850.94 -5.222 -9.95 %
8mer_H2_Db 13 TSK DCPNGHVC YTK 825.91 -5.524 -10.52 %
8mer_H2_Db 50 TVK TGVDIQCC STD 819.94 -6.316 -12.03 %
8mer_H2_Db 32 FCS IRGKRVDL GCA 938.14 -8.761 -16.69 %
8mer_H2_Db 22 VCY TKTWCDAF CSI 930.07 -9.103 -17.34 %
8mer_H2_Db 49 PTV KTGVDIQC CST 844.97 -9.479 -18.06 %
8mer_H2_Db 26 KTW CDAFCSIR GKR 896.06 -9.479 -18.06 %
8mer_H2_Db 62 TDN CNPFPTRK RP 944.12 -15.508 -29.54 %
8mer_H2_Db 28 WCD AFCSIRGK RVD 863.05 -18.667 -35.56 %
8mer_H2_Db 29 CDA FCSIRGKR VDL 948.16 -28.837 -54.93 %

Table 1a: Peptide binders of Alpha-Cobratoxin from N. kaouthia to MHC-I molecules, having C-terminal ends are proteosomal cleavage sites, Binding potential (score) of antigenic peptide to the MHC-1 Allele i.e. 8mer_H2_Db.

MHC-I Allele POS N SEQUENCE C MW SCORE % OPT.
9mer_H2_Db 57 IQC CSTDNCNPF PTR 982.05 14.379 28.55 %
9mer_H2_Db 12 ITS KDCPNGHVC YTK 954.08 7.581 15.05 %
9mer_H2_Db 13 TSK DCPNGHVCY TKT 989.09 5.283 10.49 %
9mer_H2_Db 40 VDL GCAATCPTV KTG 803.94 2.756 5.47 %
9mer_H2_Db 61 STD NCNPFPTRK RP 1058.22 1.882 3.74 %
9mer_H2_Db 21 HVC YTKTWCDAF CSI 1093.25 -0.651 -1.29 %
9mer_H2_Db 22 VCY TKTWCDAFC SIR 1033.21 -2.115 -4.20 %
9mer_H2_Db 25 TKT WCDAFCSIR GKR 1059.27 -2.581 -5.12 %
9mer_H2_Db 49 PTV KTGVDIQCC STD 948.11 -3.287 -6.53 %
9mer_H2_Db 31 AFC SIRGKRVDL GCA 1025.22 -6.633 -13.17 %
9mer_H2_Db 17 CPN GHVCYTKTW CDA 1053.22 -6.897 -13.69 %
9mer_H2_Db 60 CST DNCNPFPTR KRP 1045.14 -9.799 -19.46 %
9mer_H2_Db 11 DIT SKDCPNGHV CYT 938.02 -10.788 -21.42 %
9mer_H2_Db 27 TWC DAFCSIRGK RVD 978.14 -14.271 -28.34 %
9mer_H2_Db 1 - IRCFITPDI TSK 1059.3 -14.47 -28.73 %
9mer_H2_Db 48 CPT VKTGVDIQC CST 944.1 -20.758 -41.22 %
9mer_H2_Db 28 WCD AFCSIRGKR VDL 1019.24 -25.564 -50.76 %

Table 1b: Peptide binders of Alpha-Cobratoxin from N. kaouthia to MHC-I molecules, having C-terminal ends are proteosomal cleavage sites, the binding potential (score) of antigenic peptide to the MHC-1 Allele i.e. 9mer_H2_Db.

MHC-I Allele POS. N SEQUENCE C MW SCORE % OPT.
10mer_H2_Db 60 CST DNCNPFPTRK RP 1173.31 12.485 21.21 %
10mer_H2_Db 12 ITS KDCPNGHVCY TKT 1117.26 7.127 12.11 %
10mer_H2_Db 59 CCS TDNCNPFPTR KRP 1146.24 6.054 10.29 %
10mer_H2_Db 39 RVD LGCAATCPTV KTG 917.1 1.576 2.68 %
10mer_H2_Db 16 DCP NGHVCYTKTW CDA 1167.32 -2.258 -3.84 %
10mer_H2_Db 27 TWC DAFCSIRGKR VDL 1134.33 -5.536 -9.41 %
10mer_H2_Db 30 DAF CSIRGKRVDL GCA 1128.36 -6.587 -11.19 %
10mer_H2_Db 24 YTK TWCDAFCSIR GKR 1160.37 -6.936 -11.78 %
10mer_H2_Db 11 DIT SKDCPNGHVC YTK 1041.16 -9.087 -15.44 %
10mer_H2_Db 48 CPT VKTGVDIQCC STD 1047.24 -11.614 -19.73 %
10mer_H2_Db 10 PDI TSKDCPNGHV CYT 1039.12 -11.992 -20.37 %
10mer_H2_Db 47 TCP TVKTGVDIQC CST 1045.2 -18.063 -30.69 %
10mer_H2_Db 20 GHV CYTKTWCDAF CSI 1196.39 -18.172 -30.87 %
10mer_H2_Db 56 DIQ CCSTDNCNPF PTR 1085.19 -21.639 -36.76 %
10mer_H2_Db 21 HVC YTKTWCDAFC SIR 1196.39 -25.354 -43.08 %
10mer_H2_Db 26 KTW CDAFCSIRGK RVD 1081.28 -27.786 -47.21 %

Table 1c: Peptide binders of Alpha-Cobratoxin from N. kaouthia to MHC-I molecules, having C-terminal ends are proteosomal cleavage sites, the binding potential (score) of antigenic peptide to the MHC-1 Allele i.e. 10mer_H2_Db.

MHC-I Allele POS N SEQUENCE C MW SCORE % OPT
11mer_H2_Db 11 DIT SKDCPNGHVCY TKT 1204.34 14.334 18.03 %
11mer_H2_Db 47 TCP TVKTGVDIQCC STD 1148.34 -8.952 -11.26 %
11mer_H2_Db 26 KTW CDAFCSIRGKR VDL 1237.47 -9.5 -11.95 %
11mer_H2_Db 15 KDC PNGHVCYTKTW CDA 1264.44 -9.844 -12.38 %
11mer_H2_Db 29 CDA FCSIRGKRVDL GCA 1275.54 -14.187 -17.85 %
11mer_H2_Db 59 CCS TDNCNPFPTRK RP 1274.41 -16.292 -20.49 %
11mer_H2_Db 20 GHV CYTKTWCDAFC SIR 1299.53 -17.308 -21.77 %
11mer_H2_Db 19 NGH VCYTKTWCDAF CSI 1295.52 -18.359 -23.09 %
11mer_H2_Db 10 PDI TSKDCPNGHVC YTK 1142.26 -18.948 -23.84 %
11mer_H2_Db 23 CYT KTWCDAFCSIR GKR 1288.54 -20.282 -25.51 %
11mer_H2_Db 46 ATC PTVKTGVDIQC CST 1142.32 -20.512 -25.80 %
11mer_H2_Db 9 TPD ITSKDCPNGHV CYT 1152.28 -23.253 -29.25 %
11mer_H2_Db 55 VDI QCCSTDNCNPF PTR 1213.32 -24.834 -31.24 %
11mer_H2_Db 58 QCC STDNCNPFPTR KRP 1233.32 -24.917 -31.34 %
11mer_H2_Db 38 KRV DLGCAATCPTV KTG 1032.19 -25.364 -31.91 %
11mer_H2_Db 4 IRC FITPDITSKDC PNG 1221.39 -28.415 -35.74 %
11mer_H2_Db 25 TKT WCDAFCSIRGK RVD 1244.49 -30.115 -37.88 %

Table 1d: Peptide binders of Alpha-Cobratoxin from N. kaouthia to MHC-I molecules, having C-terminal ends are proteosomal cleavage sites the binding potential (score) of antigenic peptide to the MHC-1 Allele i.e. 11mer_H2_Db.

Peptide Rank Start Position Sequence Score Predicted Affinity
1 41 CAATCPTVK 8.618 High
2 30 CSIRGKRVD 8.586 High
3 38 DLGCAATCP 8.549 High
4 20 CYTKTWCDA 8.487 High
5 50 TGVDIQCCS 8.385 High
6 58 STDNCNPFP 8.241 High
7 7 PDITSKDCP 8.071 High
8 40 GCAATCPTV 8.010 High
9 32 IRGKRVDLG 7.958 High
10 55 QCCSTDNCN 7.872 High
11 36 RVDLGCAAT 7.814 High
12 62 CNPFPTRKR 7.738 High
13 47 TVKTGVDIQ 7.576 High
14 46 PTVKTGVDI 7.561 High
15 22 TKTWCDAFC 7.380 High
16 48 VKTGVDIQC 7.319 High
17 51 GVDIQCCST 7.318 High
18 33 RGKRVDLGC 6.855 High
19 44 TCPTVKTGV 6.789 High
20 15 PNGHVCYTK 6.764 High
21 16 NGHVCYTKT 6.535 High
22 17 GHVCYTKTW 6.355 High
23 29 FCSIRGKRV 6.308 High
24 11 SKDCPNGHV 6.130 High
25 61 NCNPFPTRK 6.085 High

Table 2: Cascade SVM based High affinity TAP Binders of Alpha-Cobratoxin from N. kaouthia.

Discussion

In this study, we found the antigenic determinants by finding the area of greatest local hydrophilicity. Hopp and Woods hydrophobicity scale is used to identify of potentially antigenic sites in proteins by analyzing amino acid sequences in order to find the point of greatest hydrophilic. Hydrophilicity Prediction result data found high in sequence position at 9-11, 13-15, 33-37 (1.243) in a protein this scale is basically a hydrophilic index where a polar residues have been assigned negative values. The Window size of 5-7 is good for finding hydrophilic regions, greater than 0 values are consider as hydrophilic which is consider as antigenic. Welling used information on the relative occurrence of amino acids in antigenic regions to make a scale which is useful for prediction of antigenic regions and the predicted result data found high in sequence position 20-21 (0.440), 36-38. Welling antigenicity plot gives value as the log of the quotient between percentage in a sample of known antigenic regions and percentage in average proteins. We also study Hydrophobicity plot of HPLC/Parker Hydrophilicity Prediction Result Data found 7-PDITSKD-13 (4.500), 8-DITSKDC-14 (4.400), 10-TSKDCPN-16 (5.414), 11-SKDCPNG-17 (5.486), 55-QCCSTDN-61 (5.357), 57-CSTDNCN-63 (5.500), 58-STDNCNP-64 (5.600) (maximum) (Figure 4). BepiPred predicts the location of linear B-cell epitopes Result found that there are 2 predicted epitopes are found 9-ITSKDCPNG-17, 45-CPTVKT-50, (Figure 5) (Table 3). There are 3 antigenic determinant sequences is found by Kolaskar and Tongaonkar antigenicity scales the results show highest pick at position 15-PNGHVCYTKT-24, 26-CDAFCSIRG-34, 36-RVDLGCAATCPTVKTGVDIQCCSTD-60, (Figure 6) (Table 4). Result of determined antigenic sites on proteins has revealed that the hydrophobic residues if they occur on the surface of a protein are more likely to be a part of antigenic sites. This method can predict antigenic determinants with about 75% accuracy and also gives the information of surface accessibility and flexibility. Further this region form beta sheet which show high antigenic response than helical region of this peptide and shows highly antigenicity. X-Ray Diffraction with Resolution 1.94 Å 3D Structure of the Alpha-Cobratoxin from N. kaouthia is predicted by PDB vive. We generate a purified protein for analysis of the chosen target and then structure determined the target experimentally to evaluate their similarity to known protein structures and to determine possible relationships that are identifiable from protein sequence alone. The target structure will also serve as a detailed model for determining the structure of peptide within that protein structure. We predict Solvent accessibility by using Emani et al., the result found the highest probability i.e. found 7-PDITSK-12(2.082),8- DITSKD-13 (2.248), 31-SIRGKR-36 (2.121), 33-RGKRVD-38 (2.798), 63-NPFPTR-68 (2.798), 64-PFPTRK-69 (3.480), 65-FPTRKR-70 (4.408), 66-PTRKRP-71 (7.872) (maximum), that a given protein region lies on the surface of a protein and are used to identify antigenic determinants on the surface of proteins. This algorithm also used to identify the antigenic determinants on the surface of proteins and Karplus and Schulz predict backbone or chain flexibility on the basis of the known temperature B factors of the a-carbons here we found the result with High score is i.e. 6-TPDITSK-12 (1.064), 7-PDITSKD-13 (1.077), 8-DITSKDC-14 (1.084) (maximum), 9-ITSKDCP-15 (1.078), 10-TSKDCPN-16 (1.074), 11-SKDCPNG-17 (1.062). We predict Solvent accessibility of Alpha-Cobratoxin from N. kaouthia for delineating hydrophobic and hydrophilic characteristics of amino acids. Solvent accessibility used to identify active site of functionally important residues in membrane proteins. Solvent-accessible surface areas and backbone angles are continuously varying because proteins can move freely in a three-dimensional space. The mobility of protein segments which are located on the surface of a protein due to an entropic energy potential and which seem to correlate well with known antigenic determinants. We also found the i.e. Sweet et al. hydrophobicity prediction result data found high in position 4 (0.461), 6-7, 21-23, Kyte and Doolittle result high in position 4, 6-7, 29-31, 40-44 (1.614), Abraham and Leo result high in position 6-7(1.230), 27-29, 40-42, Bull and Breese result high in position 13-16, 43-44, 58-61 (0.557), Guy result high in position 9-10, 13-15, 33-37, 66-68 (0.661), Miyazawa result high in position 4-7 (6.737), 27-31, 41-42, 54-57, Roseman result high in position 6-7 (0.334), 17-18, 42-45, Wolfenden result high in position 42 (0.170), Wilson et al. 4-6, 17-19, 22-23, 26-32 (3.671), 39- 40, 54-55, Cowan 4-7(0.899), 27-29, 40-42, Chothia 4-8,27-32 (0.407), 39-45, 53-57, (Figures 9-19). These scales are a hydrophilic with a polar residues assigned negative value. Because the N- and C-terminal regions of proteins are usually solvent accessible and unstructured, antibodies against those regions recognize the antigenic protein. In this study, we found predicted MHC-I peptide binders of toxin protein for 8mer_H2_Db alleles with the consensus sequence QNWNCCTI that yields the maximum score i.e. 52.494, 9mer_H2_Db with, the consensus sequence FCIHNCDYM that yields the maximum score i.e. 50.365, 10mer_H2_Db with, the consensus sequence SGYYNFFWCL that yields the maximum score i.e. 58.858, 11mer_H2_Db with, the consensus sequence CGVYNFYYCCY that yields the maximum score i.e. 79.495. We also use a cascade SVM based TAPP red method which found 25 High affinity TAP Transporter peptide regions which represents predicted TAP binders residues which occur at N and C termini from Alpha-Cobratoxin from N. kaouthia. TAP is an important transporter that transports antigenic peptides from cytosol to ER. TAP binds and translocate selective antigenic peptides for binding to specific MHC molecules. The efficiency of TAP-mediated translocation of antigenic peptides is directly proportional to its TAP binding affinity. Thus, by understanding the nature of peptides, that bind to TAP with high affinity, is important steps in endogenous antigen processing. The correlation coefficient of 0.88 was obtained by using jackknife validation test. In this test, we found the MHCI and MHCII binding regions. T cell immune responses are derived by antigenic epitopes hence their identification is important for design synthetic peptide vaccine. T cell epitopes are recognized by MHCI molecules producing a strong defensive immune response against Alpha-Cobratoxin from N. kaouthia. Therefore, the prediction of peptide binding to MHCI molecules by appropriate processing of antigen peptides occurs by their binding to the relevant MHC molecules. Because, the C-terminus of MHCI-restricted epitopes results from cleavage by the proteasome and thus, proteasome specifity is important for determine T-cell epitopes. Consequently, RANKPEP also focus on the prediction of conserved epitopes. C-terminus of MHCI-restricted peptides is generated by the proteasome, and thus RANKPEP also determines whether the C-terminus of the predicted MHCI-peptide binders is the result of proteasomal cleavage. Moreover, these sequences are highlighted in purple in the output results. Proteasomal cleavage predictions are carried out using three optional models obtained applying statistical language models to a set of known epitopes restricted by human MHCI molecules as indicated here.

No. Start Position End Position Peptide Peptide Length
1 9 17 ITSKDCPNG 9
2 45 50 CPTVKT 6

Table 3: Predicted Antigenic epitopes of Alpha-Cobratoxin from N. kaouthia Bepipred.

No. Start Position End Position Peptide Peptide Length
1 15 24 PNGHVCYTKT 10
2 26 34 CDAFCSIRG 9
3 36 60 RVDLGCAATCPTVKTGVDIQCCSTD 25

Table 4: Predicted Antigenic epitopes of Alpha-Cobratoxin from N. kaouthia.

Conclusion

From the above result and discussion it is concluded that RANKPEP predict Peptide binders of Alpha-Cobratoxin from N. kaouthia to MHC-I molecules and thereby potential T-cell epitopes. The specificity of transporter associated with antigen processing (TAP) plays an important role in the transport of the antigenic peptide fragments of the proteolysed to the endoplasmic reticulum where they associate with the major histocompatibility complex (MHC) class I molecules. Therefore, prediction of TAP-binding peptides is highly helpful in identifying the MHC class I-restricted T-cell epitopes and hence useful in the synthetic peptide vaccine designing. All above prediction methods are based on propensity scales for the 20 amino acids to describe the tendency of each residue to be associated with properties such as hydrophilicity, surface accessibility or mobility. Antigenic peptides should be located in solvent accessible regions containing both hydrophobic and hydrophilic residues. High peaks in the surface accessibility plot predict regions that have a higher chance of producing antibodies that can bind to native protein. This means the increase in affinity of MHC binding peptides may result in enhancement of immunogenicity of Alpha-Cobratoxin from N. kaouthia and are helpful in the designing of synthetic peptide vaccine. This approach can help reduce the time and cost of experimentation for determining functional properties of Alpha-Cobratoxin from N. kaouthia. Overall, the results are encouraging; both the sites of action and physiological functions can be predicted with very high accuracies helping minimize the number of validation experiments.

References

--
Post your comment

Share This Article

Recommended Journals

Article Tools

Article Usage

  • Total views: 15510
  • [From(publication date):
    December-2014 - Jul 25, 2026]
  • Breakdown by view type
  • HTML page views : 10711
  • PDF downloads : 4799
International Conferences 2026-27
 
Meet Inspiring Speakers and Experts at our 3000+ Global

Conferences by Country

Medical & Clinical Conferences

Conferences By Subject

Top Connection closed successfully.